Prophage integrase inta

Author: umem

August undefined, 2024

WebbintA: Organism: Escherichia coli (strain K12). Sequence Length: 413: Subcellular Localization: Protein Description: Integrase is necessary for integration of the phage into … Webb21 maj 2009 · After 12 h, overexpressing integrase from CP4-57 (IntA) using plasmid pCA24N- intA in an intA host led to the excision and loss of this prophage from …

Genomic analysis of a Raoultella ornithinolytica strain …

WebbW3110 Unique ID: JW2602 Gene: intA slpA intX Gene Annotation: CP4-57 prophage; integrase Webb19 juli 2024 · Satellites are mobile genetic elements that rely on helper phages for their mobilization. The many known satellite-helper interactions are trans-regulatory, with … calling rome italy from usa

Distribution of Antimicrobial Resistance and Virulence Genes ... - PubMed

WebbintA: polypeptide CP4-57 prophage; integrase IntA . Escherichia coli K-12 substr. MG1655: Synonyms: intX; slpA: Accession IDs: EG11783 (EcoCyc) b2622 ECK2618 P32053 … WebbintS (CPS-53 (KpLE1) prophage; prophage CPS-53 integrase), intZ (CPZ-55 prophage; putative phage integrase IntZ), kilR (Rac prophage; inhibitor of FtsZ), lamB (maltose … Webb22 nov. 2024 · Prophage Integrase type Mutation at the 3′ end of ssrA Reference; Escherichia coli K-12: CP4-57: P4 integrase: CGCCAGC-CCACCA: Wang et al. Shewanella … calling romeo

Prophage Integrase Typing Is a Useful Indicator of Genomic …

Prophage integrase inta

-like)ombinase)ase BRE C-like)-like)talytic SU)de 2,1-aminomutase)

Webb21 juni 2024 · The IntA integrase has been shown to intervene in biofilm formation. In E. coli, the deletion of the intA gene reduces early biofilm formation 24 whereas the … WebbbioRxiv.org - the preprint server for Biology

Did you know?

Webb10 apr. 2024 · Fig. 1: An atlas of infant gut DNA virus diversity. Faecal viromes from 647 infants at age 1 year were deeply sequenced, assembled and curated, resulting in the identification of 10,021 viral ...

WebbProphage integrase intA gene, which is necessary for the integration of the phage into the host genome by site-specific recombination (Kirby et al., 1994), was present in all … WebbDen som höres må icke förmenas att intaga sedvanliga måltider eller åtnjuta nödig vila.; Bartendern tålde episoden sämre och fick intaga sängen.; Jag hade föga lust att intaga …

WebbProphage integrase IntA UniProtKB InterPro STRING STRING Interactive Modelling 413 aa; Sequence (Fasta) ; 2 identical sequences: Escherichia sp. TM-G17TGC : A0A8F9HD04 ; … Webb946160 - Gene ResultintA integrase IntA [] intA integrase IntA [] Gene ID: 946160, updated on 9-Mar-2024 Summary IntA (SlpA) is a prophage integrase. [More information is …

Webb7 okt. 2010 · The fact that the attL region overlaps the integrase promoter has several consequences: (i) the integrase gene is likely down-regulated by itself and the RDF, as …

Webb>cp4-57 prophage; integrase inta e. coli k12. version nc_000913.3 gi:556503834 marktkpltdteikaakpkdadyqlydgdgltllikssgsklwqfryyrpltkqrtkqsf ... coburns woodstock vtWebb10 juli 2024 · Enteritidis, and 18 integrase genes in S. Heidelberg). In comparison, whole genome sequencing and PHASTER identified a total of 75 prophage integrase genes … coburn\u0027s bossier cityhttp://regulondb.ccg.unam.mx/sequence?type=PD&term=ECK120001717&format=fasta calling routerWebbintA gene in Escherichia coli K-12 genome. Gene local context to scale (view description) Gene ... CP4-57 prophage; integrase IntA: Synonym(s): IntA, IntX, SlpA: Sequence: Get … calling rows and columns in matlabWebbProtein target information for Prophage integrase IntA (Escherichia coli K-12). Find diseases associated with this biological target and compounds tested against it in … coburn\u0027s concrete new carlisleWebbLOC114255086 prophage integrase IntA-like [ (pharaoh ant)] Gene ID: 114255086, discontinued on 1-Oct-2024. Summary. DISCONTINUED: This record has been withdrawn … calling room to attention armyWebb21 maj 2009 · After 12 h, overexpressing integrase from CP4–57 (IntA) using plasmid pCA24N-intA in an intA host led to the excision and loss of this prophage from … coburn\\u0027s credit union